Lineage for d1j90a_ (1j90 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins) 
Protein Deoxyribonucleoside kinase [69478] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (1 PDB entry) 
Domain d1j90a_: 1j90 A: [66448]
Details for d1j90a_
PDB Entry: 1j90 (more details), 2.56 Å
PDB Description: Crystal Structure of Drosophila Deoxyribonucleoside Kinase
SCOP Domain Sequences for d1j90a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j90a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster)}
tqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmykdpkkwa
mpfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmyntleewyk
fieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwlihqrrp
qsckvlvldadlnle
SCOP Domain Coordinates for d1j90a_:
Click to download the PDB-style file with coordinates for d1j90a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j90a_:
- d1j90a_ is new in SCOP 1.59
- d1j90a_ appears in SCOP 1.61
- d1j90a_ appears in the current release, SCOPe 2.08
View in 3D
