Lineage for d1j8ia_ (1j8i A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498854Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 498855Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 498856Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 498920Protein Lymphotactin [69632] (1 species)
  7. 498921Species Human (Homo sapiens) [TaxId:9606] [69633] (2 PDB entries)
  8. 498922Domain d1j8ia_: 1j8i A: [66438]

Details for d1j8ia_

PDB Entry: 1j8i (more details)

PDB Description: solution structure of human lymphotactin

SCOP Domain Sequences for d1j8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ia_ d.9.1.1 (A:) Lymphotactin {Human (Homo sapiens)}
vgsevsdkrtcvslttqrlpvsriktytitegslravifitkrglkvcadpqatwvrdvv
rsmdrksntrnnmiqtkptgtqqstntavtltg

SCOP Domain Coordinates for d1j8ia_:

Click to download the PDB-style file with coordinates for d1j8ia_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ia_: