Lineage for d1j8ea_ (1j8e A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963000Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 1963001Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 1963002Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 1963012Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 1963013Species Human (Homo sapiens) [TaxId:9606] [57427] (13 PDB entries)
    Uniprot P01130 272-353
  8. 1963017Domain d1j8ea_: 1j8e A: [66437]
    seventh module
    complexed with ca

Details for d1j8ea_

PDB Entry: 1j8e (more details), 1.85 Å

PDB Description: crystal structure of ligand-binding repeat cr7 from lrp
PDB Compounds: (A:) Low-density lipoprotein receptor-related protein 1

SCOPe Domain Sequences for d1j8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
gshscsstqfkcnsgrcipehwtcdgdndcgdysdethanctnq

SCOPe Domain Coordinates for d1j8ea_:

Click to download the PDB-style file with coordinates for d1j8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ea_: