Lineage for d1j8dc_ (1j8d C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919676Family c.108.1.5: Probable phosphatase YrbI [69467] (1 protein)
    the insertion subdomain is a beta-hairpin involved into tetramerisation
  6. 2919677Protein Probable phosphatase YrbI [69468] (1 species)
  7. 2919678Species Haemophilus influenzae, HI1679 [TaxId:727] [69469] (3 PDB entries)
  8. 2919694Domain d1j8dc_: 1j8d C: [66435]
    complexed with gol

Details for d1j8dc_

PDB Entry: 1j8d (more details), 2.3 Å

PDB Description: Structure Of the metal-free form of the deoxy-D-mannose-octulosonate 8-phosphate phosphatase (YrbI) From Haemophilus Influenzae (HI1679)
PDB Compounds: (C:) deoxy-D-mannose-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d1j8dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8dc_ c.108.1.5 (C:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}
mqqklenikfvitdvdgvltdgqlhydangeaiksfhvrdglgikmlmdadiqvavlsgr
dspilrrriadlgiklfflgkleketacfdlmkqagvtaeqtayigddsvdlpafaacgt
sfavadapiyvknavdhvlsthggkgafremsdmilqaqgkssvfdtaqgflksvksmgq

SCOPe Domain Coordinates for d1j8dc_:

Click to download the PDB-style file with coordinates for d1j8dc_.
(The format of our PDB-style files is described here.)

Timeline for d1j8dc_: