Lineage for d1j83a_ (1j83 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774561Family b.18.1.12: Family 17 carbohydrate binding module, CBM17 [69219] (1 protein)
    automatically mapped to Pfam PF03424
  6. 2774562Protein Endo-1,4-beta glucanase EngF [69220] (1 species)
  7. 2774563Species Clostridium cellulovorans [TaxId:1493] [69221] (2 PDB entries)
  8. 2774564Domain d1j83a_: 1j83 A: [66430]
    CASP4
    complexed with ca

Details for d1j83a_

PDB Entry: 1j83 (more details), 1.7 Å

PDB Description: structure of fam17 carbohydrate binding module from clostridium cellulovorans
PDB Compounds: (A:) endo-1,4-beta glucanase engf

SCOPe Domain Sequences for d1j83a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j83a_ b.18.1.12 (A:) Endo-1,4-beta glucanase EngF {Clostridium cellulovorans [TaxId: 1493]}
qptapkdfssgfwdfndgttqgfgvnpdspitainvenannalkisnlnskgsndlsegn
fwanvrisadiwgqsiniygdtkltmdviaptpvnvsiaaipqssthgwgnptrairvwt
nnfvaqtdgtykatltistndspnfntiatdaadsvvtnmilfvgsnsdnisldnikftk

SCOPe Domain Coordinates for d1j83a_:

Click to download the PDB-style file with coordinates for d1j83a_.
(The format of our PDB-style files is described here.)

Timeline for d1j83a_: