SCOPe 2.03: Domain d1j7yd_: 1j7y D:

Lineage for d1j7yd_ (1j7y D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (207 PDB entries)
   Uniprot P68871

8. Domain d1j7yd_: 1j7y D: [66429]
   Other proteins in same PDB: d1j7ya_, d1j7yc_
   complexed with cmo, hem, so4; mutant

Details for d1j7yd_

PDB Entry: 1j7y, 1.7 Å

PDB Description: crystal structure of partially ligated mutant of hba

PDB Compounds: (D:) hemoglobin

SCOPe Domain Sequences for d1j7yd_:

Sequence; same for both SEQRES and ATOM records:

>d1j7yd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1j7yd_:

• d1j7yd_ first appeared in SCOP 1.59
  
• d1j7yd_ appears in SCOPe 2.02
  
• d1j7yd_ appears in SCOPe 2.04
  
• d1j7yd_ appears in the current release, SCOPe 2.08