Lineage for d1j7yb_ (1j7y B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531063Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 531125Species Human (Homo sapiens) [TaxId:9606] [46501] (159 PDB entries)
  8. 531156Domain d1j7yb_: 1j7y B: [66427]
    Other proteins in same PDB: d1j7ya_, d1j7yc_

Details for d1j7yb_

PDB Entry: 1j7y (more details), 1.7 Å

PDB Description: Crystal structure of partially ligated mutant of HbA
PDB Compounds: (B:)

SCOP Domain Sequences for d1j7yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7yb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1j7yb_:

Click to download the PDB-style file with coordinates for d1j7yb_.
(The format of our PDB-style files is described here.)

Timeline for d1j7yb_: