Lineage for d1j7sc_ (1j7s C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 148222Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 148223Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 148233Family a.1.1.2: Globins [46463] (18 proteins)
  6. 148338Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 148386Species Human (Homo sapiens) [TaxId:9606] [46487] (81 PDB entries)
  8. 148472Domain d1j7sc_: 1j7s C: [66419]
    Other proteins in same PDB: d1j7sb_, d1j7sd_

Details for d1j7sc_

PDB Entry: 1j7s (more details), 2.2 Å

PDB Description: crystal structure of deoxy hbalphayq, a mutant of hba

SCOP Domain Sequences for d1j7sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7sc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1j7sc_:

Click to download the PDB-style file with coordinates for d1j7sc_.
(The format of our PDB-style files is described here.)

Timeline for d1j7sc_: