Lineage for d1j7nb1 (1j7n B:27-263)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 507855Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 507856Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 508252Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)
  6. 508253Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 508254Species Bacillus anthracis [TaxId:1392] [69777] (7 PDB entries)
  8. 508257Domain d1j7nb1: 1j7n B:27-263 [66412]
    Other proteins in same PDB: d1j7na3, d1j7nb3

Details for d1j7nb1

PDB Entry: 1j7n (more details), 2.3 Å

PDB Description: Anthrax Toxin Lethal factor

SCOP Domain Sequences for d1j7nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7nb1 d.92.1.14 (B:27-263) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis}
ernktqeehlkeimkhivkievkgeeavkkeaaekllekvpsdvlemykaiggkiyivdg
ditkhislealsedkkkikdiygkdallhehyvyakegyepvlviqssedyventekaln
vyyeigkilsrdilskinqpyqkfldvlntiknasdsdgqdllftnqlkehptdfsvefl
eqnsnevqevfakafayyiepqhrdvlqlyapeafnymdkfneqeinlsleelkdqr

SCOP Domain Coordinates for d1j7nb1:

Click to download the PDB-style file with coordinates for d1j7nb1.
(The format of our PDB-style files is described here.)

Timeline for d1j7nb1: