Lineage for d1j78b1 (1j78 B:3-198)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1281391Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1281392Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 1281393Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 1281703Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 1281704Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 1281720Domain d1j78b1: 1j78 B:3-198 [66400]
    complexed with ola, vdy

Details for d1j78b1

PDB Entry: 1j78 (more details), 2.31 Å

PDB Description: crystallographic analysis of the human vitamin d binding protein
PDB Compounds: (B:) vitamin D binding protein

SCOPe Domain Sequences for d1j78b1:

Sequence, based on SEQRES records: (download)

>d1j78b1 a.126.1.1 (B:3-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
rgrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaeg
adpdcydtrtsalsakscesnspfpvhpgtaecctkeglerklcmaalkhqpqefptyve
ptndeiceafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvc
flkerlqlkhlslltt

Sequence, based on observed residues (ATOM records): (download)

>d1j78b1 a.126.1.1 (B:3-198) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
rgrdyeknkvckefshlgkedftslslvlysrkfpsgtfeqvsqlvkevvslteaccaeg
adpdcydtrtsalsakscesnspfpvhpgtaecctlcmaalkhqpqefptyveptndeic
eafrkdpkeyanqfmweystnygqaplsllvsytksylsmvgscctsasptvcflkerlq
lkhlslltt

SCOPe Domain Coordinates for d1j78b1:

Click to download the PDB-style file with coordinates for d1j78b1.
(The format of our PDB-style files is described here.)

Timeline for d1j78b1: