Lineage for d1j51d_ (1j51 D:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (34 PDB entries) 
Domain d1j51d_: 1j51 D: [66396]
Details for d1j51d_
PDB Entry: 1j51 (more details), 2.2 Å
PDB Description: crystal structure of cytochrome p450cam mutant (f87w/y96f/v247l/c334a) with 1,3,5-trichlorobenzene
SCOP Domain Sequences for d1j51d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j51d_ a.104.1.1 (D:) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOP Domain Coordinates for d1j51d_:
Click to download the PDB-style file with coordinates for d1j51d_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j51d_:
- d1j51d_ is new in SCOP 1.59
- d1j51d_ appears in SCOP 1.61
- d1j51d_ appears in the current release, SCOPe 2.08
View in 3D
