Lineage for d1j51c_ (1j51 C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216631Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 216632Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 216633Family a.104.1.1: Cytochrome P450 [48265] (12 proteins)
  6. 216682Protein Cytochrome P450-CAM [48266] (1 species)
  7. 216683Species Pseudomonas putida [TaxId:303] [48267] (40 PDB entries)
  8. 216729Domain d1j51c_: 1j51 C: [66395]

Details for d1j51c_

PDB Entry: 1j51 (more details), 2.2 Å

PDB Description: crystal structure of cytochrome p450cam mutant (f87w/y96f/v247l/c334a) with 1,3,5-trichlorobenzene

SCOP Domain Sequences for d1j51c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j51c_ a.104.1.1 (C:) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1j51c_:

Click to download the PDB-style file with coordinates for d1j51c_.
(The format of our PDB-style files is described here.)

Timeline for d1j51c_: