Lineage for d1j4xa_ (1j4x A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) 
Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52802] (2 PDB entries) 
Domain d1j4xa_: 1j4x A: [66392]
Details for d1j4xa_
PDB Entry: 1j4x (more details), 2.75 Å
PDB Description: human vh1-related dual-specificity phosphatase c124s mutant-peptide complex
SCOP Domain Sequences for d1j4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4xa_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens)}
svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhsreg
ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
SCOP Domain Coordinates for d1j4xa_:
Click to download the PDB-style file with coordinates for d1j4xa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j4xa_:
- d1j4xa_ first appeared in SCOP 1.59
- d1j4xa_ appears in SCOP 1.63
- d1j4xa_ appears in the current release, SCOPe 2.08
View in 3D