Lineage for d1j4ra_ (1j4r A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2185706Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2185718Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 2185722Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 2185742Domain d1j4ra_: 1j4r A: [66389]
    complexed with 001, gol, so4

Details for d1j4ra_

PDB Entry: 1j4r (more details), 1.8 Å

PDB Description: fk506 binding protein complexed with fkb-001
PDB Compounds: (A:) fk506-binding protein

SCOPe Domain Sequences for d1j4ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ra_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1j4ra_:

Click to download the PDB-style file with coordinates for d1j4ra_.
(The format of our PDB-style files is described here.)

Timeline for d1j4ra_: