Lineage for d1j4qa_ (1j4q A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108433Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
  4. 108434Superfamily b.26.1: SMAD/FHA domain [49879] (2 families) (S)
  5. 108456Family b.26.1.2: FHA domain [49885] (1 protein)
  6. 108457Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 108458Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (16 PDB entries)
  8. 108470Domain d1j4qa_: 1j4q A: [66388]

Details for d1j4qa_

PDB Entry: 1j4q (more details)

PDB Description: nmr structure of the fha1 domain of rad53 in complex with a rad9- derived phosphothreonine (at t192) peptide

SCOP Domain Sequences for d1j4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4qa_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae)}
atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa
cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg
vgvesdilslvifindkfkqcleqnkvdrir

SCOP Domain Coordinates for d1j4qa_:

Click to download the PDB-style file with coordinates for d1j4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1j4qa_: