Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.2: FHA domain [49885] (12 proteins) |
Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries) |
Domain d1j4pa_: 1j4p A: [66387] complex with a rad9-derived phosphothreonine peptide |
PDB Entry: 1j4p (more details)
SCOPe Domain Sequences for d1j4pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4pa_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atqrfliekfsqeqigenivcrvicttgqipirdlsadisqvlkekrsikkvwtfgrnpa cdyhlgnisrlsnkhfqillgedgnlllndistngtwlngqkveknsnqllsqgdeitvg vgvesdilslvifindkfkqcleqnkvdrir
Timeline for d1j4pa_: