Lineage for d1j4ka_ (1j4k A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778110Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2778138Protein Phosphotyrosine binding domain of Rad53 [49886] (1 species)
  7. 2778139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49887] (18 PDB entries)
  8. 2778151Domain d1j4ka_: 1j4k A: [66383]
    complexed with a phosphotyrosyl peptide

Details for d1j4ka_

PDB Entry: 1j4k (more details)

PDB Description: solution structure of the fha2 domain of rad53 complexed with a phosphotyrosyl peptide derived from rad9
PDB Compounds: (A:) protein kinase spk1

SCOPe Domain Sequences for d1j4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ka_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gngrfltlkplpdsiiqesleiqqgvnpffigrsedcnckiednrlsrvhcfifkkrhav
gksmyespaqglddiwychtgtnvsylnnnrmiqgtkfllqdgdeikiiwdknnkfvigf
kveindttglfneglgmlqeqrvvlkqtaeekdlvkkl

SCOPe Domain Coordinates for d1j4ka_:

Click to download the PDB-style file with coordinates for d1j4ka_.
(The format of our PDB-style files is described here.)

Timeline for d1j4ka_: