Lineage for d1j4gd_ (1j4g D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681159Protein alpha-Trichosanthin [56373] (1 species)
  7. 1681160Species Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId:3677] [56374] (9 PDB entries)
  8. 1681170Domain d1j4gd_: 1j4g D: [66382]
    complexed with ca

Details for d1j4gd_

PDB Entry: 1j4g (more details), 2 Å

PDB Description: crystal structure analysis of the trichosanthin delta c7
PDB Compounds: (D:) Trichosanthin delta C7

SCOPe Domain Sequences for d1j4gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4gd_ d.165.1.1 (D:) alpha-Trichosanthin {Mongolian snake gourd (Trichosanthes kirilowii Maxim.) [TaxId: 3677]}
mdvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadet
isvaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaag
kireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktf
lpslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsnial
l

SCOPe Domain Coordinates for d1j4gd_:

Click to download the PDB-style file with coordinates for d1j4gd_.
(The format of our PDB-style files is described here.)

Timeline for d1j4gd_: