Lineage for d1j4ed_ (1j4e D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821887Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 1821946Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (25 PDB entries)
  8. 1822043Domain d1j4ed_: 1j4e D: [66378]
    complexed with 13p

Details for d1j4ed_

PDB Entry: 1j4e (more details), 2.65 Å

PDB Description: fructose-1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate
PDB Compounds: (D:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d1j4ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ed_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
hpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrqlll
taddrvnpaiggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngett
tqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngiv
pivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghaatqky
sheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkapllkpwaltfsygr
alqasalkawggkkenlkaaqeeyvkralanslaaqgkytp

SCOPe Domain Coordinates for d1j4ed_:

Click to download the PDB-style file with coordinates for d1j4ed_.
(The format of our PDB-style files is described here.)

Timeline for d1j4ed_: