SCOPe 2.06: Domain d1j4ec_: 1j4e C:

Lineage for d1j4ec_ (1j4e C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)

7. Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (31 PDB entries)

8. Domain d1j4ec_: 1j4e C: [66377]
   complexed with 13p

Details for d1j4ec_

PDB Entry: 1j4e, 2.65 Å

PDB Description: fructose-1,6-bisphosphate aldolase covalently bound to the substrate dihydroxyacetone phosphate

PDB Compounds: (C:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d1j4ec_:

Sequence; same for both SEQRES and ATOM records:

>d1j4ec_ c.1.10.1 (C:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
hpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrqlll
taddrvnpaiggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngett
tqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngiv
pivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghaatqky
sheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkapllkpwaltfsygr
alqasalkawggkkenlkaaqeeyvkralanslaaqgkytp

Timeline for d1j4ec_:

• d1j4ec_ first appeared in SCOP 1.59
  
• d1j4ec_ appears in SCOPe 2.05
  
• d1j4ec_ appears in SCOPe 2.07
  
• d1j4ec_ appears in the current release, SCOPe 2.08