Lineage for d1j47a1 (1j47 A:2-85)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310163Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2310164Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2310165Family a.21.1.1: HMG-box [47096] (10 protein domains)
  6. 2310215Protein SRY [47104] (1 species)
  7. 2310216Species Human (Homo sapiens) [TaxId:9606] [47105] (5 PDB entries)
  8. 2310218Domain d1j47a1: 1j47 A:2-85 [66373]
    Other proteins in same PDB: d1j47a2
    protein/DNA complex; mutant

Details for d1j47a1

PDB Entry: 1j47 (more details)

PDB Description: 3D Solution NMR Structure of the M9I Mutant of the HMG-Box Domain of the Human Male Sex Determining Factor SRY Complexed to DNA
PDB Compounds: (A:) sex-determining region y protein

SCOPe Domain Sequences for d1j47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j47a1 a.21.1.1 (A:2-85) SRY {Human (Homo sapiens) [TaxId: 9606]}
qdrvkrpinafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqkl
qamhrekypnykyrprrkakmlpk

SCOPe Domain Coordinates for d1j47a1:

Click to download the PDB-style file with coordinates for d1j47a1.
(The format of our PDB-style files is described here.)

Timeline for d1j47a1: