SCOP 1.71: Domain d1it3c_: 1it3 C:

Lineage for d1it3c_ (1it3 C:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hagfish hemoglobin [68941] (1 species)

7. Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries)

8. Domain d1it3c_: 1it3 C: [66369]

Details for d1it3c_

PDB Entry: 1it3, 2.1 Å

PDB Description: Hagfish CO ligand hemoglobin

SCOP Domain Sequences for d1it3c_:

Sequence; same for both SEQRES and ATOM records:

>d1it3c_ a.1.1.2 (C:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri)}
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay

Timeline for d1it3c_:

• d1it3c_ first appeared in SCOP 1.59
  
• d1it3c_ appears in SCOP 1.69
  
• d1it3c_ appears in SCOP 1.73
  
• d1it3c_ appears in the current release, SCOPe 2.08