Lineage for d1it2a_ (1it2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299590Protein Hagfish hemoglobin [68941] (1 species)
  7. 2299591Species Inshore hagfish (Eptatretus burgeri) [TaxId:7764] [68942] (2 PDB entries)
  8. 2299592Domain d1it2a_: 1it2 A: [66365]
    complexed with hem

Details for d1it2a_

PDB Entry: 1it2 (more details), 1.6 Å

PDB Description: Hagfish deoxy hemoglobin
PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1it2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}
piidqgplptltdgdkkainkiwpkiykeyeqyslnillrflkcfpqaqasfpkfstkks
nleqdpevkhqavvifnkvneiinsmdnqeeiikslkdlsqkhktvfkvdsiwfkelssi
fvstidggaefeklfsiicillrsay

SCOPe Domain Coordinates for d1it2a_:

Click to download the PDB-style file with coordinates for d1it2a_.
(The format of our PDB-style files is described here.)

Timeline for d1it2a_: