Lineage for d1it0b2 (1it0 B:501-803)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 385002Protein Xylanase A, catalytic core [51514] (7 species)
  7. 385038Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (11 PDB entries)
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 385044Domain d1it0b2: 1it0 B:501-803 [66364]
    Other proteins in same PDB: d1it0a1, d1it0b1
    complexed with lat

Details for d1it0b2

PDB Entry: 1it0 (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with lactose

SCOP Domain Sequences for d1it0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it0b2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1it0b2:

Click to download the PDB-style file with coordinates for d1it0b2.
(The format of our PDB-style files is described here.)

Timeline for d1it0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it0b1