Lineage for d1it0b2 (1it0 B:501-803)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173642Protein Xylanase A, catalytic core [51514] (6 species)
  7. 173674Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (7 PDB entries)
  8. 173680Domain d1it0b2: 1it0 B:501-803 [66364]
    Other proteins in same PDB: d1it0a1, d1it0b1

Details for d1it0b2

PDB Entry: 1it0 (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with lactose

SCOP Domain Sequences for d1it0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it0b2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1it0b2:

Click to download the PDB-style file with coordinates for d1it0b2.
(The format of our PDB-style files is described here.)

Timeline for d1it0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it0b1