SCOP 1.69: Domain d1it0b1: 1it0 B:813-936

Lineage for d1it0b1 (1it0 B:813-936)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (6 proteins)

6. Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)

7. Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)

8. Domain d1it0b1: 1it0 B:813-936 [66363]
   Other proteins in same PDB: d1it0a2, d1it0b2

Details for d1it0b1

PDB Entry: 1it0, 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with lactose

SCOP Domain Sequences for d1it0b1:

Sequence; same for both SEQRES and ATOM records:

>d1it0b1 b.42.2.1 (B:813-936) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

Timeline for d1it0b1:

• d1it0b1 first appeared in SCOP 1.59
  
• d1it0b1 appears in SCOP 1.67
  
• d1it0b1 appears in SCOP 1.71
  
• d1it0b1 appears in the current release, SCOPe 2.08