Lineage for d1it0a2 (1it0 A:1-303)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571750Protein Xylanase A, catalytic core [51514] (8 species)
  7. 571800Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 571807Domain d1it0a2: 1it0 A:1-303 [66362]
    Other proteins in same PDB: d1it0a1, d1it0b1

Details for d1it0a2

PDB Entry: 1it0 (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with lactose

SCOP Domain Sequences for d1it0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it0a2 c.1.8.3 (A:1-303) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1it0a2:

Click to download the PDB-style file with coordinates for d1it0a2.
(The format of our PDB-style files is described here.)

Timeline for d1it0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it0a1