Lineage for d1it0a1 (1it0 A:313-436)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 800938Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 800939Family b.42.2.1: Ricin B-like [50371] (10 proteins)
  6. 801053Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 801058Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (11 PDB entries)
  8. 801065Domain d1it0a1: 1it0 A:313-436 [66361]
    Other proteins in same PDB: d1it0a2, d1it0b2

Details for d1it0a1

PDB Entry: 1it0 (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with lactose
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOP Domain Sequences for d1it0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it0a1 b.42.2.1 (A:313-436) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis [TaxId: 1921]}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOP Domain Coordinates for d1it0a1:

Click to download the PDB-style file with coordinates for d1it0a1.
(The format of our PDB-style files is described here.)

Timeline for d1it0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it0a2