SCOP 1.63: Domain d1iszb2: 1isz B:501-803

Lineage for d1iszb2 (1isz B:501-803)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.3: beta-glycanases [51487] (14 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (6 species)

7. Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (7 PDB entries)
   N-terminal domain; fused with a ricin A-like beta-trefoil domain

8. Domain d1iszb2: 1isz B:501-803 [66360]
   Other proteins in same PDB: d1isza1, d1iszb1
   complexed with gal

Details for d1iszb2

PDB Entry: 1isz, 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with galactose

SCOP Domain Sequences for d1iszb2:

Sequence; same for both SEQRES and ATOM records:

>d1iszb2 c.1.8.3 (B:501-803) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

Timeline for d1iszb2:

• d1iszb2 first appeared in SCOP 1.59
  
• d1iszb2 appears in SCOP 1.61
  
• d1iszb2 appears in SCOP 1.65
  
• d1iszb2 appears in the current release, SCOPe 2.08