Lineage for d1isza1 (1isz A:313-436)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 298063Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 298202Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 298203Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 298232Protein Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) [50377] (2 species)
  7. 298237Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (7 PDB entries)
  8. 298240Domain d1isza1: 1isz A:313-436 [66357]
    Other proteins in same PDB: d1isza2, d1iszb2

Details for d1isza1

PDB Entry: 1isz (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with galactose

SCOP Domain Sequences for d1isza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isza1 b.42.2.1 (A:313-436) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces olivaceoviridis}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOP Domain Coordinates for d1isza1:

Click to download the PDB-style file with coordinates for d1isza1.
(The format of our PDB-style files is described here.)

Timeline for d1isza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isza2