Lineage for d1isxa2 (1isx A:1-303)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116733Protein Xylanase A, catalytic core [51514] (6 species)
  7. 116765Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (7 PDB entries)
  8. 116776Domain d1isxa2: 1isx A:1-303 [66350]
    Other proteins in same PDB: d1isxa1, d1isxb1

Details for d1isxa2

PDB Entry: 1isx (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with xylotriose

SCOP Domain Sequences for d1isxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isxa2 c.1.8.3 (A:1-303) Xylanase A, catalytic core {Streptomyces olivaceoviridis}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOP Domain Coordinates for d1isxa2:

Click to download the PDB-style file with coordinates for d1isxa2.
(The format of our PDB-style files is described here.)

Timeline for d1isxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isxa1