Lineage for d1iswa2 (1isw A:1-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831125Protein Xylanase A, catalytic core [51514] (8 species)
  7. 2831181Species Streptomyces olivaceoviridis [TaxId:1921] [51519] (12 PDB entries)
    Uniprot Q7SI98
    N-terminal domain; fused with a ricin A-like beta-trefoil domain
  8. 2831202Domain d1iswa2: 1isw A:1-303 [66346]
    Other proteins in same PDB: d1iswa1, d1iswb1
    complexed with xyp

Details for d1iswa2

PDB Entry: 1isw (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with xylobiose
PDB Compounds: (A:) endo-1,4-beta-D-xylanase

SCOPe Domain Sequences for d1iswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iswa2 c.1.8.3 (A:1-303) Xylanase A, catalytic core {Streptomyces olivaceoviridis [TaxId: 1921]}
aestlgaaaaqsgryfgtaiasgklgdsayttiasrefnmvtaenemkidatepqrgqfn
fsagdrvynwavqngkqvrghtlawhsqqpgwmqslsgstlrqamidhingvmghykgki
aqwdvvneafsddgsggrrdsnlqrtgndwievafrtaraadpaaklcyndynienwtwa
ktqgvynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gassstyaavtndclavsrclgitvwgvrdtdswrsgdtpllfngdgskkaaytavlnal
ngg

SCOPe Domain Coordinates for d1iswa2:

Click to download the PDB-style file with coordinates for d1iswa2.
(The format of our PDB-style files is described here.)

Timeline for d1iswa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iswa1