Lineage for d1isvb1 (1isv B:804-936)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111186Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 111187Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 111188Protein Endo-1,4-beta-xylanase C-terminal domain [50377] (1 species)
  7. 111189Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (7 PDB entries)
  8. 111197Domain d1isvb1: 1isv B:804-936 [66343]
    Other proteins in same PDB: d1isva2, d1isvb2

Details for d1isvb1

PDB Entry: 1isv (more details), 2.1 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with xylose

SCOP Domain Sequences for d1isvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1isvb1 b.42.2.1 (B:804-936) Endo-1,4-beta-xylanase C-terminal domain {Streptomyces olivaceoviridis}
sstpppsgggqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygd
kcldaagtgngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqly
scsngsnqrwtrt

SCOP Domain Coordinates for d1isvb1:

Click to download the PDB-style file with coordinates for d1isvb1.
(The format of our PDB-style files is described here.)

Timeline for d1isvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1isvb2