Lineage for d1is8t_ (1is8 T:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) 
Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein) Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (3 PDB entries) 
Domain d1is8t_: 1is8 T: [66340]
Other proteins in same PDB: d1is8a_, d1is8b_, d1is8c_, d1is8d_, d1is8e_, d1is8f_, d1is8g_, d1is8h_, d1is8i_, d1is8j_
Details for d1is8t_
PDB Entry: 1is8 (more details), 2.7 Å
PDB Description: crystal structure of rat gtpchi/gfrp stimulatory complex plus zn
SCOP Domain Sequences for d1is8t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is8t_ d.205.1.1 (T:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke
SCOP Domain Coordinates for d1is8t_:
Click to download the PDB-style file with coordinates for d1is8t_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1is8t_:
- d1is8t_ is new in SCOP 1.59
- d1is8t_ appears in SCOP 1.61
- d1is8t_ appears in the current release, SCOPe 2.08
View in 3D
