SCOPe 2.01: Domain d1is8l_: 1is8 L:

Lineage for d1is8l_ (1is8 L:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta, antiparallel beta-sheet: order 342165

4. Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family)

5. Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein)

6. Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69764] (4 PDB entries)
   Uniprot P70552

8. Domain d1is8l_: 1is8 L: [66332]
   Other proteins in same PDB: d1is8a_, d1is8b_, d1is8c_, d1is8d_, d1is8e_, d1is8f_, d1is8g_, d1is8h_, d1is8i_, d1is8j_
   complexed with k, phe, zn

Details for d1is8l_

PDB Entry: 1is8, 2.7 Å

PDB Description: crystal structure of rat gtpchi/gfrp stimulatory complex plus zn

PDB Compounds: (L:) GTP Cyclohydrolase I Feedback Regulatory Protein

SCOPe Domain Sequences for d1is8l_:

Sequence; same for both SEQRES and ATOM records:

>d1is8l_ d.205.1.1 (L:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl
ecrgfrvlsmtgvgqtlvwclhke

Timeline for d1is8l_:

• d1is8l_ first appeared in SCOP 1.59
  
• d1is8l_ appears in SCOP 1.75
  
• d1is8l_ appears in SCOPe 2.02
  
• d1is8l_ appears in the current release, SCOPe 2.08