Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.205: GTP cyclohydrolase I feedback regulatory protein, GFRP [69760] (1 superfamily) |
Superfamily d.205.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69761] (1 family) |
Family d.205.1.1: GTP cyclohydrolase I feedback regulatory protein, GFRP [69762] (1 protein) |
Protein GTP cyclohydrolase I feedback regulatory protein, GFRP [69763] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [69764] (3 PDB entries) |
Domain d1is7p_: 1is7 P: [66316] Other proteins in same PDB: d1is7a_, d1is7b_, d1is7c_, d1is7d_, d1is7e_, d1is7f_, d1is7g_, d1is7h_, d1is7i_, d1is7j_ |
PDB Entry: 1is7 (more details), 2.8 Å
SCOP Domain Sequences for d1is7p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is7p_ d.205.1.1 (P:) GTP cyclohydrolase I feedback regulatory protein, GFRP {Rat (Rattus norvegicus)} mpyllistqirmevgptmvgdehsdpelmqqlgaskrrvlgnnfyeyyvndpprivldkl ecrgfrvlsmtgvgqtlvwclhke
Timeline for d1is7p_: