SCOP 1.59: Domain d1irqb_: 1irq B:

Lineage for d1irqb_ (1irq B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.43: Met repressor-like [47597] (1 superfamily)

4. Superfamily a.43.1: Met repressor-like [47598] (2 families)

5. Family a.43.1.2: Bacterial repressors [47604] (3 proteins)

6. Protein Omega transcriptional repressor [69031] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [69032] (1 PDB entry)

8. Domain d1irqb_: 1irq B: [66298]

Details for d1irqb_

PDB Entry: 1irq, 1.5 Å

PDB Description: Crystal structure of omega transcriptional repressor at 1.5A resolution

SCOP Domain Sequences for d1irqb_:

Sequence; same for both SEQRES and ATOM records:

>d1irqb_ a.43.1.2 (B:) Omega transcriptional repressor {Streptococcus pyogenes}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d1irqb_:

• d1irqb_ is new in SCOP 1.59
  
• d1irqb_ appears in SCOP 1.61
  
• d1irqb_ appears in the current release, SCOPe 2.08