SCOP 1.59: Domain d1irqa_: 1irq A:

Lineage for d1irqa_ (1irq A:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.43: Met repressor-like [47597] (1 superfamily)

4. Superfamily a.43.1: Met repressor-like [47598] (2 families)

5. Family a.43.1.2: Bacterial repressors [47604] (3 proteins)

6. Protein Omega transcriptional repressor [69031] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [69032] (1 PDB entry)

8. Domain d1irqa_: 1irq A: [66297]

Details for d1irqa_

PDB Entry: 1irq, 1.5 Å

PDB Description: Crystal structure of omega transcriptional repressor at 1.5A resolution

SCOP Domain Sequences for d1irqa_:

Sequence; same for both SEQRES and ATOM records:

>d1irqa_ a.43.1.2 (A:) Omega transcriptional repressor {Streptococcus pyogenes}
imgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

Timeline for d1irqa_:

• d1irqa_ is new in SCOP 1.59
  
• d1irqa_ appears in SCOP 1.61
  
• d1irqa_ appears in the current release, SCOPe 2.08