Lineage for d1irjg_ (1irj G:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213190Family a.39.1.2: S100 proteins [47478] (1 protein)
    dimer: subunits are made of two EF-hands
  6. 213191Protein Calcyclin (S100) [47479] (15 species)
  7. 213237Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (1 PDB entry)
  8. 213244Domain d1irjg_: 1irj G: [66295]

Details for d1irjg_

PDB Entry: 1irj (more details), 2.1 Å

PDB Description: Crystal Structure of the MRP14 complexed with CHAPS

SCOP Domain Sequences for d1irjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irjg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14)}
ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
medldtnadkqlsfeefimlmarl

SCOP Domain Coordinates for d1irjg_:

Click to download the PDB-style file with coordinates for d1irjg_.
(The format of our PDB-style files is described here.)

Timeline for d1irjg_: