Lineage for d1irje_ (1irj E:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152497Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (1 PDB entry)
  8. 152502Domain d1irje_: 1irj E: [66293]

Details for d1irje_

PDB Entry: 1irj (more details), 2.1 Å

PDB Description: Crystal Structure of the MRP14 complexed with CHAPS

SCOP Domain Sequences for d1irje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irje_ a.39.1.2 (E:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14)}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarl

SCOP Domain Coordinates for d1irje_:

Click to download the PDB-style file with coordinates for d1irje_.
(The format of our PDB-style files is described here.)

Timeline for d1irje_: