| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (1 protein) dimer: subunits are made of two EF-hands |
| Protein Calcyclin (S100) [47479] (16 species) |
| Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (1 PDB entry) |
| Domain d1irjb_: 1irj B: [66290] |
PDB Entry: 1irj (more details), 2.1 Å
SCOP Domain Sequences for d1irjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irjb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14)}
ckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehi
medldtnadkqlsfeefimlmarl
Timeline for d1irjb_: