Lineage for d1irja_ (1irj A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087651Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1087652Protein Calcyclin (S100) [47479] (17 species)
  7. 1087778Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (2 PDB entries)
  8. 1087785Domain d1irja_: 1irj A: [66289]
    complexed with ca, cps

Details for d1irja_

PDB Entry: 1irj (more details), 2.1 Å

PDB Description: Crystal Structure of the MRP14 complexed with CHAPS
PDB Compounds: (A:) Migration Inhibitory Factor-Related Protein 14

SCOPe Domain Sequences for d1irja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irja_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]}
tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
imedldtnadkqlsfeefimlmarl

SCOPe Domain Coordinates for d1irja_:

Click to download the PDB-style file with coordinates for d1irja_.
(The format of our PDB-style files is described here.)

Timeline for d1irja_: