Lineage for d1irja_ (1irj A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 152429Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 152430Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 152453Family a.39.1.2: S100 proteins [47478] (1 protein)
  6. 152454Protein Calcyclin (S100) [47479] (13 species)
  7. 152497Species Human (Homo sapiens), s100a9 (mrp14) [TaxId:9606] [69020] (1 PDB entry)
  8. 152498Domain d1irja_: 1irj A: [66289]

Details for d1irja_

PDB Entry: 1irj (more details), 2.1 Å

PDB Description: Crystal Structure of the MRP14 complexed with CHAPS

SCOP Domain Sequences for d1irja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irja_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14)}
tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
imedldtnadkqlsfeefimlmarl

SCOP Domain Coordinates for d1irja_:

Click to download the PDB-style file with coordinates for d1irja_.
(The format of our PDB-style files is described here.)

Timeline for d1irja_: