Lineage for d1irha_ (1irh A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342705Fold g.8: BPTI-like [57361] (1 superfamily)
    disulphide-rich alpha+beta fold
  4. 342706Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 342707Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (12 proteins)
  6. 342829Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 342830Species Human (Homo sapiens) [TaxId:9606] [57369] (3 PDB entries)
  8. 342833Domain d1irha_: 1irh A: [66288]
    third kunitz domain

Details for d1irha_

PDB Entry: 1irh (more details)

PDB Description: the solution structure of the third kunitz domain of tissue factor pathway inhibitor

SCOP Domain Sequences for d1irha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irha_ g.8.1.1 (A:) Tissue factor pathway inhibitor {Human (Homo sapiens)}
efhgpswcltpadrglcranenrfyynsvigkcrpfkysgcggnennftskqeclrackk
g

SCOP Domain Coordinates for d1irha_:

Click to download the PDB-style file with coordinates for d1irha_.
(The format of our PDB-style files is described here.)

Timeline for d1irha_: