Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (5 proteins) contains only one 4Fe-4S cluster automatically mapped to Pfam PF13459 automatically mapped to Pfam PF13370 |
Protein Ferredoxin [54882] (1 species) |
Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (2 PDB entries) |
Domain d1ir0a_: 1ir0 A: [66282] complexed with sf4, so4 |
PDB Entry: 1ir0 (more details), 1 Å
SCOPe Domain Sequences for d1ir0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ir0a_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg cptdsikvadepfdgdpnkfe
Timeline for d1ir0a_: