Lineage for d1ir0a_ (1ir0 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723374Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) (S)
  5. 723447Family d.58.1.4: Single 4Fe-4S cluster ferredoxin [54877] (4 proteins)
    contains only one 4Fe-4S cluster
  6. 723454Protein Ferredoxin [54882] (1 species)
  7. 723455Species Bacillus thermoproteolyticus [TaxId:1427] [54883] (3 PDB entries)
  8. 723457Domain d1ir0a_: 1ir0 A: [66282]
    complexed with fs4, sul

Details for d1ir0a_

PDB Entry: 1ir0 (more details), 1 Å

PDB Description: oxidized [4fe-4s] ferredoxin from bacillus thermoproteolyticus (form ii)
PDB Compounds: (A:) ferredoxin

SCOP Domain Sequences for d1ir0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ir0a_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]}
pkytivdketciacgacgaaapdiydydedgiayvtlddnqgivevpdiliddmmdafeg
cptdsikvadepfdgdpnkfe

SCOP Domain Coordinates for d1ir0a_:

Click to download the PDB-style file with coordinates for d1ir0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ir0a_: