SCOPe 2.01: Domain d1iqwl2: 1iqw L:112-215

Lineage for d1iqwl2 (1iqw L:112-215)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (318 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1iqwl2: 1iqw L:112-215 [66280]
   Other proteins in same PDB: d1iqwh1, d1iqwh2, d1iqwl1
   part of anti-human Fas Fab hfe7a

Details for d1iqwl2

PDB Entry: 1iqw, 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a

PDB Compounds: (L:) antibody m-hfe7a, light chain

SCOPe Domain Sequences for d1iqwl2:

Sequence; same for both SEQRES and ATOM records:

>d1iqwl2 b.1.1.2 (L:112-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1iqwl2:

• d1iqwl2 first appeared in SCOP 1.59
  
• d1iqwl2 appears in SCOP 1.75
  
• d1iqwl2 appears in SCOPe 2.02
  
• d1iqwl2 appears in the current release, SCOPe 2.08