SCOPe 2.01: Domain d1iqwl1: 1iqw L:1-111

Lineage for d1iqwl1 (1iqw L:1-111)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d1iqwl1: 1iqw L:1-111 [66279]
   Other proteins in same PDB: d1iqwh1, d1iqwh2, d1iqwl2
   part of anti-human Fas Fab HFE7a

Details for d1iqwl1

PDB Entry: 1iqw, 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a

PDB Compounds: (L:) antibody m-hfe7a, light chain

SCOPe Domain Sequences for d1iqwl1:

Sequence; same for both SEQRES and ATOM records:

>d1iqwl1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleik

Timeline for d1iqwl1:

• d1iqwl1 first appeared in SCOP 1.59
  
• d1iqwl1 appears in SCOP 1.75
  
• d1iqwl1 appears in SCOPe 2.02
  
• d1iqwl1 appears in the current release, SCOPe 2.08