SCOPe 2.06: Domain d1iqwh1: 1iqw H:1-121

Lineage for d1iqwh1 (1iqw H:1-121)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1iqwh1: 1iqw H:1-121 [66277]
   Other proteins in same PDB: d1iqwh2, d1iqwl1, d1iqwl2
   part of anti-human Fas Fab hfe7a

Details for d1iqwh1

PDB Entry: 1iqw, 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a

PDB Compounds: (H:) antibody m-hfe7a, heavy chain

SCOPe Domain Sequences for d1iqwh1:

Sequence; same for both SEQRES and ATOM records:

>d1iqwh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
s

Timeline for d1iqwh1:

• d1iqwh1 first appeared in SCOP 1.59
  
• d1iqwh1 appears in SCOPe 2.05
  
• d1iqwh1 appears in SCOPe 2.07
  
• d1iqwh1 appears in the current release, SCOPe 2.08