SCOP 1.59: Domain d1iqra2: 1iqr A:2-171

Lineage for d1iqra2 (1iqr A:2-171)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.28: N-terminal domain of DNA photolyase [52424] (1 superfamily)

4. Superfamily c.28.1: N-terminal domain of DNA photolyase [52425] (1 family)

5. Family c.28.1.1: N-terminal domain of DNA photolyase [52426] (1 protein)

6. Protein N-terminal domain of DNA photolyase [52427] (3 species)

7. Species Thermus thermophilus [TaxId:274] [69460] (1 PDB entry)

8. Domain d1iqra2: 1iqr A:2-171 [66276]
   Other proteins in same PDB: d1iqra1

Details for d1iqra2

PDB Entry: 1iqr, 2.1 Å

PDB Description: Crystal structure of DNA photolyase from Thermus thermophilus

SCOP Domain Sequences for d1iqra2:

Sequence; same for both SEQRES and ATOM records:

>d1iqra2 c.28.1.1 (A:2-171) N-terminal domain of DNA photolyase {Thermus thermophilus}
gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpg

Timeline for d1iqra2:

• d1iqra2 is new in SCOP 1.59
  
• d1iqra2 appears in SCOP 1.61
  
• d1iqra2 appears in the current release, SCOPe 2.08